PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 289aa    MW: 31678.3 Da    PI: 6.7249
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623681.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14143187347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
   XP_013623681.1 143 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 187
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.2313285IPR017884SANT domain
SMARTSM007171.0E-63385IPR001005SANT/Myb domain
CDDcd001672.04E-63682No hitNo description
SuperFamilySSF466891.44E-93687IPR009057Homeodomain-like
PROSITE profilePS5129420.491136192IPR017930Myb domain
SuperFamilySSF466894.16E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17139191IPR006447Myb domain, plants
SMARTSM007173.2E-13140190IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-12140186IPR009057Homeodomain-like
PfamPF002495.0E-13143187IPR001005SANT/Myb domain
CDDcd001671.21E-11143188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEILRPATTS HVSVGNWLME ETESNVPLAA SPDAATWTVA ENKAFENALA VYDDNTPDRW  60
QKVAAAIPGK TVSDVIKQYN DLEADLSSIE AGLIPVPGYI TSPFTLDWAA GGGCDGFKPG  120
HPVGNKRSTA GRSPELERKK GVPWTEEEHK LFLMGLKKYG KGDWRNISRN FVITRTPTQV  180
ASHAQKYFIR QHSGGKDKRR ASIHDITTVN LQDEASLETS KSSIVAREQR SRLAAFPWSQ  240
TDNNGTHADA FNITIGNAIS GVHSYGQALL GPFNTVDSCY DAQNTMFQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-17371021176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623681.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-106DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3B2R60.0A0A0D3B2R6_BRAOL; Uncharacterized protein
STRINGBra006741.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.10.0Homeodomain-like transcriptional regulator